NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151671_1004768

Scaffold Ga0151671_1004768


Overview

Basic Information
Taxon OID3300011253 Open in IMG/M
Scaffold IDGa0151671_1004768 Open in IMG/M
Source Dataset NameSeawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterToyama Prefectural University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)694
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location NameJapan Sea near Toyama Prefecture, JAPAN
CoordinatesLat. (o)37.04027Long. (o)137.37583Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048362Metagenome / Metatranscriptome148N
F056671Metagenome / Metatranscriptome137Y
F076607Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0151671_10047681F076607AGGMTRYKQHIIDELAKLQFDYAECKIEMDEFIAGITRLGVDSPGDIEEHRSNAEEARYDYKVSKHEDKF*
Ga0151671_10047682F056671N/AMEVIMRIMMTLTGLILGMLGMITAIHSDHEILGILISFAGVVTMLSGLPDNQRNR*
Ga0151671_10047683F048362AGGAMLNKLQNWLMNVAAKWIWIAIMLPIRIILGLFFAISKHMPNKVELPYKIVKNEQTKERWYN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.