NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151620_1014079

Scaffold Ga0151620_1014079


Overview

Basic Information
Taxon OID3300011268 Open in IMG/M
Scaffold IDGa0151620_1014079 Open in IMG/M
Source Dataset NameSub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2827
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta

Source Dataset Sampling Location
Location NameSan Francisco Estuary Delta, California, USA
CoordinatesLat. (o)37.986944Long. (o)-121.523611Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000447Metagenome / Metatranscriptome1128Y
F004840Metagenome / Metatranscriptome421Y
F007263Metagenome / Metatranscriptome354Y
F085262Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0151620_10140792F085262AGGAGGMNNLYSILAELHPAGDFTEADLWEAIAESQGVDVNEIMDQDLTEYL*
Ga0151620_10140796F004840N/AMRLRKRIGEQLMYKLTCAYDSNAPHWSAEYENEFGAWENFFLFTDWGFADEYSTVNLYTPTGKCYTKVFYREGRRVVVK*
Ga0151620_10140797F000447GAGGMGYIEIFRMDQDGAGWVDLSEATPDELFNIELGLLNEGALFTTPEAD*
Ga0151620_10140798F007263AGGAVLNIIDKTDFYEIADEQHFCCDESQFKYYCIEHLEFMGCYFCGFDYDKDCEEQH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.