Basic Information | |
---|---|
Taxon OID | 3300011268 Open in IMG/M |
Scaffold ID | Ga0151620_1101937 Open in IMG/M |
Source Dataset Name | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 904 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | San Francisco Estuary Delta, California, USA | |||||||
Coordinates | Lat. (o) | 37.986944 | Long. (o) | -121.523611 | Alt. (m) | Depth (m) | .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034567 | Metagenome / Metatranscriptome | 174 | Y |
F082590 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0151620_11019372 | F082590 | AGGAGG | MLTVPRFSDTITEEQYEKLTRLPYERKPDHPDEIRSSINFSELHESIREIVARLPVVEFPNSFFDYFLSGEQQFYLVTYKEKVFLVDTQGYDYARYVVQLKDLVVMEKEKPAETMLMKAHPGSVETVIDILNHMEVDGETMEFILEQTAMKGQMLRQLFLKAHKDIIRDLSEERKQLERTI* |
Ga0151620_11019373 | F034567 | AGGA | LKELFNYYDYVNHYGNRMFAIAGVNAMPARYSSILFTGSYEECMQRLNPVGLEGSFEDFQNKVAIPKQNSYL* |
⦗Top⦘ |