Scaffold Ga0138386_1023731

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138386_1023731

Scaffold Ga0138386_1023731

Overview

Basic Information
Taxon OID	3300011317 Open in IMG/M
Scaffold ID	Ga0138386_1023731 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_B metaT (Metagenome Metatranscriptome) (version 2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	659
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location Name	Southern Atlantic Ocean
Coordinates	Lat. (^o)	-28.2362	Long. (^o)	-38.4949	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084249	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138386_10237311	F084249	N/A	PAWNKLNDAKIQEFDIKIRDHKGRDIPAETLPNFNMTLIFETIDEIDYQKEHTKEYLREPYRKEHNYRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.