NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153697_1552

Scaffold Ga0153697_1552


Overview

Basic Information
Taxon OID3300011334 Open in IMG/M
Scaffold IDGa0153697_1552 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)10843
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (68.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameDaesunglee, Gyeonggi-do, South Korea
CoordinatesLat. (o)37.6746111Long. (o)127.3841278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002420Metagenome / Metatranscriptome560Y
F100698Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0153697_155211F100698N/AMVVVFGIILPIIGMMYLDILEAKQETKRQQAVVQRLINKAEENK*
Ga0153697_155214F002420AGGGGGMSFRETTIKYIKDILRAKTISEVIYAELQEAHLRKLEAETAAEYSDAAIKYNDKRIERLERRLFEHRQDDN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.