NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153702_1722

Scaffold Ga0153702_1722


Overview

Basic Information
Taxon OID3300011337 Open in IMG/M
Scaffold IDGa0153702_1722 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)10539
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NamePaju, Gyeonggi-do, South Korea
CoordinatesLat. (o)37.6518694Long. (o)126.72164723Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009684Metagenome314Y
F015976Metagenome / Metatranscriptome250Y
F054038Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0153702_172214F015976N/AMKSKLFSTYTLIFLLILASCSANYHVRKAIKKGYRCDTIADTITINSIDSIPYVLRDSIAWERVIVQKDTIVRYKRSYVPKTRLETRIEYRLKRDTLKLIEKVEVVKYKTDRNKNKKPNLWLFIIGFGAGFITNWLLKFSKIPL*
Ga0153702_17222F009684N/AMIYKLTYENKDKALADLKEKGIIVDVEFNGEKNEAYGQGVQAVVELGLIMVTPPVMEGMEIVTPPVYADGYHYDVMSENEYDFGANLVEPKNPKHAFAGHAVKEEFPYTPQFLENGVQE*
Ga0153702_17223F054038N/AMAYKNNGVFNVKYKTRNKIARTLKQIIASEALIDTGSLYDSIRINAQIPALGELEIQIIAMYYFGFLNNGTINMAAFDLCAKLTEALNANGTTAEIFEQYTEWMTQRYPILQVATILGEKRSLIYTFEPIGGEFNAALTFRGF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.