Scaffold Ga0153700_10107

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153700_10107

Scaffold Ga0153700_10107

Overview

Basic Information
Taxon OID	3300011339 Open in IMG/M
Scaffold ID	Ga0153700_10107 Open in IMG/M
Source Dataset Name	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	37403
Total Scaffold Genes	67 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	51 (76.12%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location Name	Seoul, South Korea
Coordinates	Lat. (^o)	37.5254611	Long. (^o)	127.0168945	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012116	Metagenome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153700_1010710	F012116	N/A	MKPLAFLVEEFDSTGQLVWSGLMTSEPTSLEICKDIKNKLHNWTITPLLPDTKNIIKVNNIKKYNSKLLTEAYGGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.