 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300011410 Open in IMG/M |
| Scaffold ID | Ga0137440_1074684 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 675 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9779 | Long. (o) | -107.0028 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094358 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137440_10746841 | F094358 | N/A | MLDLDGLQVAYLGVALAHYLDLETGDIIDLPLEAEPPGEDDRFLRIPTRTPESEVEDRRLCVEKMPLSAMRDQLTRTIDDWNAFRHVLLEDRKTERQFFNFKNDQATRAIEAWLTSEGIDPSS* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |