Basic Information | |
---|---|
Taxon OID | 3300011418 Open in IMG/M |
Scaffold ID | Ga0153954_1058961 Open in IMG/M |
Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 970 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida, Wekiwa Springs State Park | |||||||
Coordinates | Lat. (o) | 28.7104 | Long. (o) | -81.4844 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015352 | Metagenome / Metatranscriptome | 255 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153954_10589612 | F015352 | GGAG | MRFPLRFLLTDGALFLLAAPTPVLAQAPAVSFPQVTEVPVPLQSVSGRFSSLNPRNQADCDYKRISGRVVSPRLVLVKDMSCGRPGHDDVLVNVLFANPADAAEMVTGRRVTIKGTFKNAQEDRDPVFVAQFLIAQNAAFVSGDRIDRAAPPPRPFTSYMVCQPPELDALATRLGKELCVQSTILPDLKGWGPSLEAAARTPADIA |
⦗Top⦘ |