NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137451_1000057

Scaffold Ga0137451_1000057


Overview

Basic Information
Taxon OID3300011438 Open in IMG/M
Scaffold IDGa0137451_1000057 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)37207
Total Scaffold Genes52 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (80.77%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9779Long. (o)-107.0032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077361Metagenome / Metatranscriptome117Y
F095634Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0137451_10000573F095634GGAGMINIAVADRSMVQDVLWRLREDDAAEMTAAGTDIERLAAQLMRFKMFAFCAWSLDHGPISVWGAIQKRQGVCAGFAFGTDDWGRAVLPMVRQIRNFVLPLLIDLGIHRVEAAALLRRDDVRRFMTLIGAKAEGVLSGYGTEGEDFVSYRWLADEYGGNRAEAAQADCAHTAH*
Ga0137451_10000578F077361GAGGMGGKGGSGPSNNQAVQLQMQQAQEAKDKENLRQARLNQGKTAIDSIFGNENFGDPFYEKYRKAGLDYTLPQLQSQYGEAKRTAEADLARAGLLRSGAAGFVQNKLTEQLGVNEAGLRAKADTDTAELRKSIAAQQQQAYNQLYATEDPTVAANTAANSAGNAQLTQPNVSALGDMFKPIAIGLGSAVAPVIGQSENNRLLSAASGRGQGNITNTPS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.