Basic Information | |
---|---|
Taxon OID | 3300011444 Open in IMG/M |
Scaffold ID | Ga0137463_1375965 Open in IMG/M |
Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.9776 | Long. (o) | -107.0024 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F093402 | Metagenome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137463_13759651 | F093402 | N/A | VWTTDNQLQQQIRNGAAKVGANAVIVNPVEQNKTAVKVLGEVIGTKSATQKASALAIYMPRDAARVRTACGN* |
⦗Top⦘ |