NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119794_1035557

Scaffold Ga0119794_1035557


Overview

Basic Information
Taxon OID3300011970 Open in IMG/M
Scaffold IDGa0119794_1035557 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Los Angeles, CA, USA - S12-02-D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Los Angeles
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: Los Angeles
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040685Metagenome161N

Sequences

Protein IDFamilyRBSSequence
Ga0119794_10355571F040685N/AMKKLLFKLFFALAFTSISLHGQERIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKLLMRQNKDLPEEISLPNTPENWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTDKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.