Scaffold Ga0119777_1010695

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119777_1010695

Scaffold Ga0119777_1010695

Overview

Basic Information
Taxon OID	3300011980 Open in IMG/M
Scaffold ID	Ga0119777_1010695 Open in IMG/M
Source Dataset Name	Human oral microbial communities from Los Angeles, CA, USA - S01-01-D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Los Angeles
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2351
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location Name	USA: Los Angeles
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049707	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119777_10106956	F049707	AGGAG	VVSEYRSPHNDGHDPYILIWEYGNDIRRAEFSERWAEYDETGWTIWYFRLVDGGIMTFSAREWEQKDDVNHLTTIWMKPSLYDIERKEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.