NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153800_1001050

Scaffold Ga0153800_1001050


Overview

Basic Information
Taxon OID3300011995 Open in IMG/M
Scaffold IDGa0153800_1001050 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2480
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)41.935556Long. (o)-81.653889Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016388Metagenome / Metatranscriptome247N
F062727Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
Ga0153800_10010502F016388AGGAMNSAIAKALDLGQRLVSLFIASALPIITGGAILGVDVVKSAGVAGLTALFGVVQKLAAASVDGELTADEISAAFGTAKKKK*
Ga0153800_10010504F062727N/AVDGGWALILSAVVTAVGGVLVTLIAQFRKENKEDHAVVAGMLSHIYRSVGRVETKVDKVENKLNDHIKEHNRS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.