Scaffold Ga0119951_1003269

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119951_1003269

Scaffold Ga0119951_1003269

Overview

Basic Information
Taxon OID	3300012000 Open in IMG/M
Scaffold ID	Ga0119951_1003269 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8468
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (76.92%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	34.21	Long. (^o)	-83.96	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003640	Metagenome / Metatranscriptome	475	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119951_100326911	F003640	AGG	MALALVYDPRYHSFVSWASLMCEAYGGQNLEIPSSEEDWKGWAVGLKGIDVFTNEAIPGPYIYENWYDWAQALVGAVSQPTE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.