NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153799_1000083

Scaffold Ga0153799_1000083


Overview

Basic Information
Taxon OID3300012012 Open in IMG/M
Scaffold IDGa0153799_1000083 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33971
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)48 (84.21%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.581667Long. (o)-79.9225Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012965Metagenome / Metatranscriptome275Y
F025995Metagenome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0153799_100008329F025995GGAMEIIIASIIRHLLTLVAGGLLTVGVSEAESHQLAEAATPVVSGAILYGVSQVWSLKDKKAR*
Ga0153799_100008341F012965AGGMSLVTAVQNVANEAGYTVESGVTASTEVTTKQLRVMAQRINKEIADAFPWPKLYASGSITLVAGQASYQLPAAFSWYHYETFWNSSTRWRILGPMSPQEYAEVRGYGLNTTVYQRFQVQGLTNSELLISPTPSASQNGNIIIFEYIADRCVRPATWTTGTVYAAGAYTFYNGNYYQTTLGGTSGVTAPTHTTGSVTDGGVIWTYYSGAYSDFLADSDETVFNQKTLEQGMLERFAEIHGLSTVQPRFITQMNEDYSRQQVSKIIYAGGHTRAELFARAGTAVFGTWT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.