Basic Information | |
---|---|
Taxon OID | 3300012016 Open in IMG/M |
Scaffold ID | Ga0120387_1169136 Open in IMG/M |
Source Dataset Name | Sheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1397 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Missouri |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 740 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 41.314168 | Long. (o) | -105.584589 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013263 | Metagenome | 272 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120387_11691361 | F013263 | GAGG | METNKLKELRELRNQEKAIKARIDEISGKATDEAVAILAAKGLEKGEFEVEGVGKFQLQRTDVFDFADYRRYPQEQAVKWRENAKEKLKEQNLVKARTAVMNGYVKTFVELYPDKEPDEIKLTVKVIE* |
⦗Top⦘ |