NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120192_10037585

Scaffold Ga0120192_10037585


Overview

Basic Information
Taxon OID3300012021 Open in IMG/M
Scaffold IDGa0120192_10037585 Open in IMG/M
Source Dataset NameTerrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)826
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location NameUSA: Kessler Farm Field Laboratory (KFFL), Okalahoma
CoordinatesLat. (o)34.975667Long. (o)-97.519Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003512Metagenome / Metatranscriptome482Y
F009420Metagenome / Metatranscriptome318Y

Sequences

Protein IDFamilyRBSSequence
Ga0120192_100375851F003512GGAMTNQSAAANAHHLATPFPGPQPWEAPDPLPVMRRELKLLLIEMNVLRVEVEQLRAMKREAGNREELLSASVNRLMESRNHWRREAERLRALITQVPPWSLFWWHCVDAFKAWRKPTDLHCA*
Ga0120192_100375852F009420GGAMADQNEAKTKTIGFLPIEKVQTLKGWDEYLDKSTQLSILRTEAQKAKNAVRDALKERLNDYGDIDFVGEGDRIRVFRVF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.