NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137389_10427952

Scaffold Ga0137389_10427952


Overview

Basic Information
Taxon OID3300012096 Open in IMG/M
Scaffold IDGa0137389_10427952 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1132
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018153Metagenome236Y
F091653Metagenome107N

Sequences

Protein IDFamilyRBSSequence
Ga0137389_104279521F091653AGGAMKRAITTITIALILTLATPVAAHGAKTTSLSFTNIPLLRPDGNSEPELSIGPDGTTVYVALSWTQFFTNTWKGGFGQVPQFQGTIDANLANNVGGGGDADVDIGSTGTLHVSTLIFFFNPQTHITQLGVSAITCPNADTSNNFSHCTGQII
Ga0137389_104279522F018153N/AMRLSGTLRSRETIVLALLATAVLAAVTYGSVTYQTPYGCGPNGVAQGPGIDWQVIAEPCIYIYFTGIVGGSVLLILLIPVPEKKAELSSGLK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.