NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153990_1119264

Scaffold Ga0153990_1119264


Overview

Basic Information
Taxon OID3300012169 Open in IMG/M
Scaffold IDGa0153990_1119264 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)588
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: North Carolina, Jones Lake State Park
CoordinatesLat. (o)34.5815Long. (o)-78.4487Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045974Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0153990_11192641F045974N/AGIRWQLGNTKEDGMTQDLILELNLALIPEERLANQHIALSKQLAGRYPAVIRLNGVTPRLAFMPHLTLYQVPIKVQDMPALYAELAQLTANAPALLLTATEFASNEHEGSFEVRYDAASELMQLQDDLLAAVNPLRGNLLLERDPAGHKLTDLITEPGTAGDNIRRTGFDAVGDPTQGGLFHPHVTINWFELGTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.