NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153922_1004112

Scaffold Ga0153922_1004112


Overview

Basic Information
Taxon OID3300012181 Open in IMG/M
Scaffold IDGa0153922_1004112 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4053
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: New Jersey, Brendon T. Byrne State Forest
CoordinatesLat. (o)39.9181Long. (o)-74.5218Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012499Metagenome / Metatranscriptome280Y
F047879Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0153922_10041123F012499N/AMVALAEPPIKDPIADYLAMNVPDRIANVGRLLVIKKVEVDLEGNGKNDVFVGTWYRNSGPDTWLWTGYASTAGGYNRITPVDSDVLIDFDGIYVGYIPDIGHNGMAQAYSLELNNKDRDQSNMISDLTFYYLEDGRLVQKGTGALDRDDPDQAAKFEYYFGPNRKLSGTPKVESFTVMELAQRGYHVPVWRSDAPPGAK*
Ga0153922_10041124F047879N/AMLLLATALAQNPPATGNPYAARGNPKSPGGKYEWTVRTTNPIRYELVDLSDERVVVTVNAYYPDANSSNIRYAKACGIFWNNDGTLVALDELNRRRAGHLYFFVLRHGAARELRSVNIVPIPPYAVEGRVVVDPGWLSGTKIRVRQALKTKTGEFVSKYFIIDFANLDSPRIQKES*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.