NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136712_1000020

Scaffold Ga0136712_1000020


Overview

Basic Information
Taxon OID3300012266 Open in IMG/M
Scaffold IDGa0136712_1000020 Open in IMG/M
Source Dataset NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13015
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (19.23%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023555Metagenome / Metatranscriptome209Y
F025977Metagenome / Metatranscriptome199Y
F048942Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0136712_100002010F048942N/AMIKVKELKDDVVINIQVNKSFYLMTKAASFVLLQNMDIPEKGDAYFKDIMNKEYNDLDEQQRAFYTLALLLAEIETQATRNNLYNEKEIPEPGDEGYVAPKLD*
Ga0136712_10000206F023555N/AMSSNLRKEKEREFYMQHMDAFKAIGIADPFFTIKTAFFKKGKFGRQCQFFEWELKKGEDIYIEFYDNAYDGNGRTIDIVPMNEDRALFKLKFNPYFQEEYDVIEGVDSEGKPDRKYLIPVNEMMVVLSSGQEISHSLYEKRKEDAKNDLPELQKSLSLFPDFEKEYSPKVEEVSLNEGDESVSDILMRISVEFEKLAKRL*
Ga0136712_10000208F025977N/AMKEIFKKLADNGITPNAFYILDCVKEGIVPNTYVKASLEVTRLIKDNWLTQDLELTDKSIIFTTEIDGYFKRSKKKTSTDLLGHNFMQNIEAYVHIFPNKKLSSGKYARVPAKNLESGFRWFFETYNYDWETIFQATQKYVGEYESKNFEYMRTAQYFLRKQNVDKSWDSDLATYCEYLKDNPDDEQVHFGELIV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.