Basic Information | |
---|---|
Taxon OID | 3300012337 Open in IMG/M |
Scaffold ID | Ga0118302_104128 Open in IMG/M |
Source Dataset Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100586 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Pennsylvania |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 957 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076912 | Metagenome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118302_1041282 | F076912 | N/A | LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSKSVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS* |
⦗Top⦘ |