NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157138_1010270

Scaffold Ga0157138_1010270


Overview

Basic Information
Taxon OID3300012352 Open in IMG/M
Scaffold IDGa0157138_1010270 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Baxter Creek, Ontario, Canada - S37
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1542
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameFraserville, Ontario
CoordinatesLat. (o)44.16961Long. (o)-78.4089Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003542Metagenome / Metatranscriptome480Y
F084218Metagenome112N

Sequences

Protein IDFamilyRBSSequence
Ga0157138_10102701F084218N/AMSDSHSVWEVGMRHEAGIRAKIHALVGIHREDGIGLCDEIKDIAGPDYTDYNEDGFGLKYRTIHSWFKPYIGE*
Ga0157138_10102703F003542N/AMSKVNFDYDLFSEKIGYDSQNKMYLIRVYDLLVFEMNTNPNPTWTGIMRKMLGDNPNNCVPSSYYSSVRRCLKEIGVCYFDTTKRCMVKGNNWDRFVSDEDWSWFIMRTGSCEYSTIVK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.