 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300012394 Open in IMG/M |
| Scaffold ID | Ga0123365_1236085 Open in IMG/M |
| Source Dataset Name | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1316 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisana Shelf, Hypoxic Zone, Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.8679 | Long. (o) | -90.4764 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040131 | Metagenome / Metatranscriptome | 162 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123365_12360852 | F040131 | N/A | MKDWIVMMLAGGTIVLLFVITLGDFYNAIQTNRPPDKDVINLLSMAITGIVGIIAGFISGKNAADQAKQQAEAQGAK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |