NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0150984_117824001

Scaffold Ga0150984_117824001


Overview

Basic Information
Taxon OID3300012469 Open in IMG/M
Scaffold IDGa0150984_117824001 Open in IMG/M
Source Dataset NameCombined assembly of Soil carbon rhizosphere
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1142
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location
Location NameHopland, California, USA
CoordinatesLat. (o)38.97364Long. (o)-123.117453Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000818Metagenome / Metatranscriptome878Y
F004649Metagenome / Metatranscriptome429Y

Sequences

Protein IDFamilyRBSSequence
Ga0150984_1178240012F004649AGGAGMEQRQEKKDRFQIEPLEERIAPSNANFPPGQFPSGNPAHAPGQSNPNEVPATNPSNG*
Ga0150984_1178240014F000818AGGAGMEQRQEKKDRFRIDQLEERIAPAIVAVQINGGGNTPNGNANGGPITNVNPAGHAPPGQN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.