NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157341_1040239

Scaffold Ga0157341_1040239


Overview

Basic Information
Taxon OID3300012494 Open in IMG/M
Scaffold IDGa0157341_1040239 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)539
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9076Long. (o)-79.0506Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099723Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0157341_10402391F099723N/APSVLFSPDGGLRVELGSLSQTTKNLLREGITGEYLFILPKYLFESRTNYADVEFLVYLNFFVRYGTRTRIVGTARQRDVLEHLLRLTIFGLFDPHAHEQPSFETLHSLYNVPDRETYALFRMLYEKYGVRQNCCATGAILALDAYIDFVVLDDTARPLLITSSQQGITPHQAAPPEVYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.