NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157319_1003520

Scaffold Ga0157319_1003520


Overview

Basic Information
Taxon OID3300012497 Open in IMG/M
Scaffold IDGa0157319_1003520 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)975
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9076Long. (o)-79.0506Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055804Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0157319_10035201F055804N/AMRHQKTSIAFLFLIFYVLIINSASGIDQSWSIYPEKEGKFEMKYPSSWITGDTFNESNEDGLKFYTDIQNKYQTNEIMQVGIGHRDAELVAPGMNLNTTLRLDSVLFIKKFKDELQNFSVLGEPNFNKYNINGHPSLYFEFSYVKSLVPKKGFFIASDINNSIFYILFEPDQSDFIKTLPIANEIISSVKLHIQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.