Basic Information | |
---|---|
Taxon OID | 3300012502 Open in IMG/M |
Scaffold ID | Ga0157347_1026552 Open in IMG/M |
Source Dataset Name | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 706 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.9076 | Long. (o) | -79.0506 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003755 | Metagenome / Metatranscriptome | 470 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157347_10265521 | F003755 | GAG | MNATVFEFPTVESLSDEIRGVVYERQTLRAVGASREELERNRAELVLLQQELVRALIRRHIPATAA* |
⦗Top⦘ |