NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118248_106076

Scaffold Ga0118248_106076


Overview

Basic Information
Taxon OID3300012607 Open in IMG/M
Scaffold IDGa0118248_106076 Open in IMG/M
Source Dataset NameHuman skin bacterial and viral communities - University of Pennsylvania - MG100535
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Pennsylvania
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)605
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076912Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0118248_1060761F076912N/ALGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.