Scaffold Ga0157210_1000331

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157210_1000331

Scaffold Ga0157210_1000331

Overview

Basic Information
Taxon OID	3300012665 Open in IMG/M
Scaffold ID	Ga0157210_1000331 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Talbot River, Ontario, Canada - S11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21580
Total Scaffold Genes	39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (53.85%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location Name	Douro-Dummer, Ontario
Coordinates	Lat. (^o)	44.4982	Long. (^o)	-79.1546	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079591	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157210_100033119	F079591	N/A	MQQTEIQFFYPLTEQTSLELDFTQTEQWIAEWQKRQWNTTTLSGSLLISNGGTGVTSWTGATSSYQTEFVIRPSEKNVGKWEITDHMFVYRRTKPNAVVRFFAKLLLGFKWHDEI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.