NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157210_1003572

Scaffold Ga0157210_1003572


Overview

Basic Information
Taxon OID3300012665 Open in IMG/M
Scaffold IDGa0157210_1003572 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Talbot River, Ontario, Canada - S11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3531
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameDouro-Dummer, Ontario
CoordinatesLat. (o)44.4982Long. (o)-79.1546Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024788Metagenome / Metatranscriptome204Y
F088906Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0157210_10035727F088906N/AMEKQLAKIVNKGLAGEPENIVLQVIDTLKIIEFSQIKHVDEAGVIRDVTLIDDTLDQPEIQHILRNMGHDVEITFDENDNVTIYF*
Ga0157210_10035728F024788N/AMSLDEKTMKLNEQRFATIVILCNVLDTEEGVSHHIKSAICASLINMLERSMNDDDGALVNLINNSIDNFCAIVEAEKGIENYRDTLTDTVQLAKKLVDEINTKARRIKEGEDILKSICLN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.