Scaffold Ga0157210_1039118

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157210_1039118

Scaffold Ga0157210_1039118

Overview

Basic Information
Taxon OID	3300012665 Open in IMG/M
Scaffold ID	Ga0157210_1039118 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Talbot River, Ontario, Canada - S11
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	733
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location Name	Douro-Dummer, Ontario
Coordinates	Lat. (^o)	44.4982	Long. (^o)	-79.1546	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004305	Metagenome / Metatranscriptome	444	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157210_10391182	F004305	AGGAG	MENEVKEIQSEQVRQKTRMAAGAWITGESLKEQSKATMPEANSDHGNFSQPKGVDKSNA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.