NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157208_10000127

Scaffold Ga0157208_10000127


Overview

Basic Information
Taxon OID3300012667 Open in IMG/M
Scaffold IDGa0157208_10000127 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Maskinonge River, Ontario, Canada - S15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26540
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKeswick, Ontario
CoordinatesLat. (o)44.22385Long. (o)-79.4212Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083913Metagenome112N

Sequences

Protein IDFamilyRBSSequence
Ga0157208_1000012715F083913GAGGMNKLLKAWNYLNARLKEPSTHASVAALATMAGVNIDATPVVHDSLTAASVVFGMIGLFVSEGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.