NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157570_1078507

Scaffold Ga0157570_1078507


Overview

Basic Information
Taxon OID3300012698 Open in IMG/M
Scaffold IDGa0157570_1078507 Open in IMG/M
Source Dataset NameDystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES071 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1659
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040464Metagenome / Metatranscriptome161N
F096608Metagenome / Metatranscriptome104N
F105037Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0157570_10785072F096608GAGMNPKIELVKEILQIIDTLTPMEIKTIPESVVLRLYQLKKRVKELDPSWEFNDPYNHYIFRILILLDALEVDETFSLEKHGKICQMIHREVRDIRRINSLWRMNTSLVVEFINSTPLKEEEREREKDKLPENLVDKEGLSPFKSITN*
Ga0157570_10785073F040464N/AMKIDKKTRSYKNKVYTFKYKTTNPMVSLEWLRRGYAFVGQTQEHLKDILKELTLKMRTMTDKEIEKDLRKGLKVTGDITLELSRFVRQGLEQKRTFKGLLGTLIETKNWALIKLTLEVTKELKERDSSSSLLFSIAKEILRELQRIQAIIPIKELKQMETSLIDIQYWKLTRHLRI*
Ga0157570_10785074F105037N/AGAEDEEMVTSHLFHERDLALRGVALILATIRDNTTLEENLGGYKELHKYIQILKKLDPKWKLVLYYIGNCIRLKHYSCDCHSFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.