NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157611_1040745

Scaffold Ga0157611_1040745


Overview

Basic Information
Taxon OID3300012724 Open in IMG/M
Scaffold IDGa0157611_1040745 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1626
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005452Metagenome / Metatranscriptome400N
F005946Metagenome / Metatranscriptome385Y
F091350Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0157611_10407451F091350GGAGMAEEAIAFNKQELRSVLSAFKAMDEEAVKEAKSVSNGLATYLQSKIIGAASSRPNQAASRIAQGSRVSKSSKIGELSFGFVSQKFS
Ga0157611_10407454F005452N/AMSIESAIRTPLKTALSTIAANVYNGIPETMTSPSICLIPDAPYLESVLINGATTKVKVNLTVTGVVAYMNNAAALDNLEKLMISIISAMPSGYEVGNVNQPQPLEVGAGSYLTADLQVSTYYTN*
Ga0157611_10407455F005946N/ALYASTPPIENAILVVAVEIFQSITAPGNQIMSDNFQPSPFILGRSLSNRVIGLLGPFLDVETMCQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.