Scaffold Ga0160429_1002683

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0160429_1002683

Scaffold Ga0160429_1002683

Overview

Basic Information
Taxon OID	3300012888 Open in IMG/M
Scaffold ID	Ga0160429_1002683 Open in IMG/M
Source Dataset Name	Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - R
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9314
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface → Solar Panel Surface Microbial Communities From Lawrence Berkeley National Laboratory, California, Usa

Source Dataset Sampling Location
Location Name	USA: Building 30, Lawrence Berkeley National Lab, Berkeley, California
Coordinates	Lat. (^o)	37.876387	Long. (^o)	-122.246777	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104247	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160429_10026832	F104247	N/A	VTGTPSPLRLFPTEAAAKKAGLVLADFRGERLSVVLYALLPEGEKKSTYLLSSSIRLTVAERRWVEEHQATVTKLGTFYPGRNFAPLQINMLRQRKSTEQD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.