NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160427_10191628

Scaffold Ga0160427_10191628


Overview

Basic Information
Taxon OID3300012894 Open in IMG/M
Scaffold IDGa0160427_10191628 Open in IMG/M
Source Dataset NameSolar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - L
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)838
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface → Solar Panel Surface Microbial Communities From Lawrence Berkeley National Laboratory, California, Usa

Source Dataset Sampling Location
Location NameUSA: Building 30, Lawrence Berkeley National Lab, Berkeley, California
CoordinatesLat. (o)37.876387Long. (o)-122.246777Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059667Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0160427_101916281F059667N/ANTKCNAKNLFKVALFTEKPPQMNSTISCPNQGIALIRLVITVAPHKLICP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.