Scaffold Ga0160422_10110046

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0160422_10110046

Scaffold Ga0160422_10110046

Overview

Basic Information
Taxon OID	3300012919 Open in IMG/M
Scaffold ID	Ga0160422_10110046 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1629
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location Name	The Central Pacific Ocean
Coordinates	Lat. (^o)	10.0	Long. (^o)	-145.0	Alt. (m)		Depth (m)	60
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066700	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160422_101100462	F066700	GGAG	MTPMFGFGMLAMGFVAIIIATIIAYFIINKVIKDENNTDN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.