NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163110_10001935

Scaffold Ga0163110_10001935


Overview

Basic Information
Taxon OID3300012928 Open in IMG/M
Scaffold IDGa0163110_10001935 Open in IMG/M
Source Dataset NameMarine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10581
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (60.87%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location NameCosta Rica: the Eastern Pacific
CoordinatesLat. (o)2.0416Long. (o)-97.0511Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000681Metagenome / Metatranscriptome939Y
F024645Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0163110_1000193518F000681N/AMNKGVEKMYKRDDYYYSVISTEDLYKELNTNYTGETDLVQSLMSRAISNGWVQTRHELGVANEELWSLNDWPEGEGFGSSDHFEYDRRIQESIAFERKFLQAENELVQINKLTESPTNDTVRKYMTMNEKLKEGMVA*
Ga0163110_100019357F024645N/AMKQGVEMQKNKKQFYITELHMGDDGLEDYSDHSGPFTLNKARKIMERLMKGNDPWVNPYAMTIRGPRHMNGYGHNTEFYSHREDR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.