NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163109_10347767

Scaffold Ga0163109_10347767


Overview

Basic Information
Taxon OID3300012936 Open in IMG/M
Scaffold IDGa0163109_10347767 Open in IMG/M
Source Dataset NameMarine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1085
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location NameCosta Rica: the Eastern Pacific
CoordinatesLat. (o)9.5025Long. (o)-92.3286Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000302Metagenome / Metatranscriptome1337Y
F024645Metagenome / Metatranscriptome205Y
F092187Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0163109_103477671F092187N/ADYADEWWCMDCEHGPMDEKDDKCDRCGAKNSQYHGEEEITGWEDEDIESEVEEIW*
Ga0163109_103477672F000302GGAGGMVATMSADTKLRIADLERQKIELENQLETLGYANNLVRMHKIEEEIFEIEDTIKKLLP*
Ga0163109_103477673F024645N/AMNKGVEMQKNKRQFYITELNMGDDGLESTTDHSGPFTLAKARKIMERMLKGTDPWINPYAMSIRGPRHTNCRGYNTEFYSHREDR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.