 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300012936 Open in IMG/M |
| Scaffold ID | Ga0163109_10686494 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 749 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Costa Rica: the Eastern Pacific | |||||||
| Coordinates | Lat. (o) | 9.5025 | Long. (o) | -92.3286 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003188 | Metagenome / Metatranscriptome | 502 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0163109_106864941 | F003188 | N/A | MTQPIKRIRQTLFSIHPLSYRIKRTTLDKPTMEKVLFKKILAQLKKIDERRDFMHSEIGMDMTQYEDQFFDVIENLMKMHFNKHQLGLIQTYLYQLVPDKDWDGTITLEKNKKEIVHPFKTPEDVWEVISKF* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |