NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153798_10100043

Scaffold Ga0153798_10100043


Overview

Basic Information
Taxon OID3300012949 Open in IMG/M
Scaffold IDGa0153798_10100043 Open in IMG/M
Source Dataset NameSwitchgrass enrichment cultures co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1344
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location NameUSA: Dartmouth College, New Hampshire
CoordinatesLat. (o)43.726Long. (o)-72.1429Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029451Metagenome / Metatranscriptome188N
F079824Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0153798_101000432F029451N/AVYEMAVDLEDLIASSSTAGQPSIIEALLSTVDSIFTNNRMLQRSRLSPRNIRGVVRVIGSQAFLRARLERSYKPFLDPDTGEFTYGRYDNRVLTAICEGVLSGRISLDGKSRDEIIRIFQAVGSTVQEEPAGKSGILGRFDY*
Ga0153798_101000433F079824AGGAGGMIYGFFGSIPGCPHNRGNHALRGNGKTLCLTFVGYLDSLRGRHVISNYKTSFSEYVPVEEIARMVVEENIRDTTILITEMQVYLNSLGVNSNDLKEFIGSVVGQSRKRNTDIHYDTQRYGDIHPRLRVQTDRAFLPRKFHRDGMPCSMDRCTEDHIIYLYQHDPYLPYEVIRLNAKAFGELYNTDEIIAVPKKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.