Basic Information | |
---|---|
Taxon OID | 3300012949 Open in IMG/M |
Scaffold ID | Ga0153798_10124184 Open in IMG/M |
Source Dataset Name | Switchgrass enrichment cultures co-assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1102 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Dartmouth College, New Hampshire | |||||||
Coordinates | Lat. (o) | 43.726 | Long. (o) | -72.1429 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007513 | Metagenome / Metatranscriptome | 349 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153798_101241841 | F007513 | AGG | VEVRETVVVTVLQRVVALPVVLLIVFSTAMDHGTEGLEEVTMHHAFLVVVFVSLAVDGTGDTLCLTLLTLL* |
⦗Top⦘ |