Scaffold Ga0163108_10247798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163108_10247798

Scaffold Ga0163108_10247798

Overview

Basic Information
Taxon OID	3300012950 Open in IMG/M
Scaffold ID	Ga0163108_10247798 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1144
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location Name	The Central Pacific Ocean
Coordinates	Lat. (^o)	10.0	Long. (^o)	-145.0	Alt. (m)		Depth (m)	155
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055785	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163108_102477983	F055785	N/A	WSILILIYFFIGCASSVPSERWSDESITLATTLTSLSVLDARQTFHMEEYRSYYDRIEPISYAHEVNPLIGTSPTQDRVVMVKVLSGALMYFGLNKMKEKNRKKALTYLNVFYFMVVLHNASLGLMS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.