Scaffold Ga0163180_10833044

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163180_10833044

Scaffold Ga0163180_10833044

Overview

Basic Information
Taxon OID	3300012952 Open in IMG/M
Scaffold ID	Ga0163180_10833044 Open in IMG/M
Source Dataset Name	Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	725
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	North Atlantic Ocean
Coordinates	Lat. (^o)	26.049	Long. (^o)	-17.4585	Alt. (m)		Depth (m)	80
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005684	Metagenome / Metatranscriptome	393	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163180_108330442	F005684	GAG	MDKCYPDRIEGVGGSLTVYDTEESPLSKMHVVRRKSEAREGRLCNRNELGQAYSDPEKVRFPELSWNEQLHRSKSKQVRMASTGPGRMHS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.