NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163179_10119499

Scaffold Ga0163179_10119499


Overview

Basic Information
Taxon OID3300012953 Open in IMG/M
Scaffold IDGa0163179_10119499 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1931
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Atlantic Ocean
CoordinatesLat. (o)34.876Long. (o)-13.1352Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000379Metagenome / Metatranscriptome1211Y
F024645Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0163179_101194991F000379GGAGGMNKIDYESKKEIMVGYIDRSSNICAVQSGWKTTPEEMAKFLDREYPTKEDSITVVDSPVLVPTFRREDYWGVDGFGDVIESNLSWHKEDMRKDVGHLFCHMTGVWKYSDNGIDWTPIREEFAEEFKEVA*
Ga0163179_101194992F024645N/AMKTGVEMQKNKKQFYITELHFGDDGLESYTDHSGPHTLNKARNIMEKLFKNPGQWINPYLMDIRGPRHENKYGHRTEFYQHREDR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.