NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134087_10011301

Scaffold Ga0134087_10011301


Overview

Basic Information
Taxon OID3300012977 Open in IMG/M
Scaffold IDGa0134087_10011301 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3090
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028975Metagenome / Metatranscriptome190Y
F072166Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0134087_100113011F072166AGGAVGEGVGEDDGVGLGVDEATATVAVTLGDGETAAGCPHAASNTSATSKTRAIT
Ga0134087_100113013F028975N/AMLAAAGLLATACFGKFALGVTQTIEPNPILPGASVKQEVNVDADGLLGSAVKQAMTDAATKSQAQGQTGTQWQIRDNSEGAAVHLRMSRSVSLAEAQTAVAKTSTGGFDVGTISVHADDWLIARHYTVRVVVSPSAPTSPTGTPTATDATSQQLAQAILAGITYDYFVSVPGVVTATNGVPGDNSRLVWHLDLTGTSERVLTAESIYPDVPRLVVLLVLFILLGSGIVFRSRSSRRVVAEQTPPTIRPQV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.