NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123348_10000647

Scaffold Ga0123348_10000647


Overview

Basic Information
Taxon OID3300012979 Open in IMG/M
Scaffold IDGa0123348_10000647 Open in IMG/M
Source Dataset NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung B1 Day 1 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26106
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (20.83%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location NamePoint Reyes National Seashore, California, USA
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071326Metagenome / Metatranscriptome122Y
F072445Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0123348_1000064716F071326GAGMASKLLEKANKLYSIGMKNIKLQLNLLGTDFVAQRPKDNSKWKNVFGGSYSSDSTLENDYDQFTVRLIINQNELTDVWNRNRDTVEVYTDNGNLEVGDELQYTRNNRTFRFKVSMKQGYSEVANVFYVYTLSSIIETMSM*
Ga0123348_1000064719F072445N/AMSTVAELVRGGGASYMQFIDWEKTYKDNNKEFLRGDMWEFSFTNAPKIVYYPGDAIFNARLNQVNVGIDTSVNGFEKRMRGNFSVFQQTGQNTAGTISLGFVDREDQAITYFLDDWHQKIADRDTKYSFRKDDLVADCKLVFTNSSRIAVRTLEFFNCIITDKTIDENGVGEDGSDRSDVQVTMKFEHYRRTFNNI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.