NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164306_11279674

Scaffold Ga0164306_11279674


Overview

Basic Information
Taxon OID3300012988 Open in IMG/M
Scaffold IDGa0164306_11279674 Open in IMG/M
Source Dataset NameSoil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)618
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Mt. Pleasant research farm, Cornell University, New York
CoordinatesLat. (o)42.4531Long. (o)-76.3842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039837Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0164306_112796741F039837N/ANGTSWNIKEITVGLTILRSPEADSARSGAARLMPAAQTTTLLSEKHPDSTVLYHLKGSAAPSSTTVFHENLGVAPGQDQEWHWAIVQAKGVPSTKPETVAPAAAP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.